PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT17444
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 396aa    MW: 42975.9 Da    PI: 7.7645
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT17444genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161963147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++l+++a +++G   W++I +++g ++t+ q++s+ qk+
         EMT17444 19 REKWTEEEHKLFLEAMQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 63
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0231468IPR017930Myb domain
SuperFamilySSF466891.42E-151468IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-151766IPR006447Myb domain, plants
SMARTSM007174.9E-131866IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-101959IPR009057Homeodomain-like
PfamPF002491.6E-141962IPR001005SANT/Myb domain
CDDcd001672.52E-102164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MAEARLPKAR KPYMITKQRE KWTEEEHKLF LEAMQLHGRA WRRIQEHIGT KTAVQIRSHA  60
QKFFSKVTRD SSGDSGGSSS GAGPPIQIPP PRPKRKSVRP YPCNLRSAQP GKRAPALLRV  120
DKPQLSMCEQ GNGSPTSVVT TSQIGLGGSE SFDSDTSTID VEERCPTPST GTAEVAVQAP  180
PTNDSKKSKG SSSTSEEVVC DNASDAPVLK LFGKTVVVNE SHQLPSPGTC DLQTAADMEL  240
DTSSETLTSA PEANTWSPWL ANSQQFMYYV PQGAVFFGYN NGSVPYPMSS SPKADQQHQH  300
QASEAAAELR RREASSNTAS SSVAETTARN SAESCTGAVG DDNEMVHAAG LRERVSPAFV  360
QQRGFMPYKR CAAETKAMQP QAPREEADRE MTRLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3550060.0AK355006.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1014J06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580392.10.0PREDICTED: protein REVEILLE 7-like
TrEMBLN1QYY20.0N1QYY2_AEGTA; Myb-like protein G
STRINGMLOC_62877.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.26e-32MYB_related family protein